PARP11 antibody

Catalog No. ABIN633008

Product Details anti-PARP11 Antibody

Target: PARP11 (Poly (ADP-Ribose) Polymerase Family, Member 11 (PARP11))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PARP11 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PARP11 antibody was raised using a synthetic peptide corresponding to a region with amino acids SAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PARP11

Target: PARP11 (Poly (ADP-Ribose) Polymerase Family, Member 11 (PARP11))

Alternative Name: PARP11 (PARP11 Products)

Background: The PARP11 gene is part of the poly (ADP-ribose) polymerase family.

Molecular Weight: 39 kDa (MW of target protein)