IQCD antibody (N-Term)

Catalog No. ABIN633012

This anti-IQCD antibody is a Rabbit Polyclonal antibody detecting IQCD in WB. Suitable for Human.

Quick Overview for IQCD antibody (N-Term) (ABIN633012)

Target: IQCD (IQ Motif Containing D (IQCD))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IQCD antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-IQCD Antibody

Binding Specificity: N-Term

Specificity: IQCD antibody was raised against the N terminal of IQCD

Purification: Affinity purified

Immunogen: IQCD antibody was raised using the N terminal of IQCD corresponding to a region with amino acids ALDILAMAPLYQAPAINRIGPKTDPSKRPADPLKPLVLSRTKLTTIEAKR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IQCD Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this IQCD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IQCD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IQCD

Target: IQCD (IQ Motif Containing D (IQCD))

Alternative Name: IQCD

Background: IQCD contains 1 IQ domain. The function of the IQCD protein is not known.

Molecular Weight: 40 kDa (MW of target protein)