C6orf154 antibody (Middle Region)

Catalog No. ABIN633015

This anti-C6orf154 antibody is a Rabbit Polyclonal antibody detecting C6orf154 in WB. Suitable for Rat, Human and Mouse.

Quick Overview for C6orf154 antibody (Middle Region) (ABIN633015)

Target: C6orf154 (Chromosome 6 Open Reading Frame 154 (C6orf154))

Reactivity: Rat, Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C6orf154 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-C6orf154 Antibody

Binding Specificity: Middle Region

Specificity: C6 ORF154 antibody was raised against the middle region of C6 rf154

Purification: Affinity purified

Immunogen: C6 ORF154 antibody was raised using the middle region of C6 rf154 corresponding to a region with amino acids NLDYNPLGDHVAGMLAVAVASSRTLEVLDLEGTGLTNQSAQTLLDMVENY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C6ORF154 Blocking Peptide, (ABIN5612533), is also available for use as a blocking control in assays to test for specificity of this C6ORF154 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF154 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C6orf154

Target: C6orf154 (Chromosome 6 Open Reading Frame 154 (C6orf154))

Alternative Name: C6ORF154

Background: The function of Chromosome 6 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 33 kDa (MW of target protein)