FAM78A antibody (N-Term)

Catalog No. ABIN633017

The Rabbit Polyclonal anti-FAM78A antibody has been validated for WB. It is suitable to detect FAM78A in samples from Human, Mouse and Rat.

Quick Overview for FAM78A antibody (N-Term) (ABIN633017)

Target: FAM78A (Family with Sequence Similarity 78, Member A (FAM78A))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM78A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FAM78A Antibody

Binding Specificity: N-Term

Specificity: FAM78 A antibody was raised against the N terminal of FAM78

Purification: Affinity purified

Immunogen: FAM78 A antibody was raised using the N terminal of FAM78 corresponding to a region with amino acids MPGFFCDCWPSLEIRALLYAMGCIQSIGGKARVFREGITVIDVKASIDPV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM78A Blocking Peptide, (ABIN5613503), is also available for use as a blocking control in assays to test for specificity of this FAM78A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM78A

Target: FAM78A (Family with Sequence Similarity 78, Member A (FAM78A))

Alternative Name: FAM78A

Background: The function of FAM78A has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 32 kDa (MW of target protein)