S100PBP antibody (Middle Region)

Catalog No. ABIN633020

The Rabbit Polyclonal anti-S100PBP antibody has been validated for WB. It is suitable to detect S100PBP in samples from Human.

Quick Overview for S100PBP antibody (Middle Region) (ABIN633020)

Target: S100PBP (S100P Binding Protein (S100PBP))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This S100PBP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-S100PBP Antibody

Binding Specificity: Middle Region

Specificity: S100 PBP antibody was raised against the middle region of S100 BP

Purification: Affinity purified

Immunogen: S100 PBP antibody was raised using the middle region of S100 BP corresponding to a region with amino acids ERRLGKVIPVLQTKTRTNVPTFSQSNLEQQKQLYLRSVIAHIEDPEDTNQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

S100PBP Blocking Peptide, (ABIN938099), is also available for use as a blocking control in assays to test for specificity of this S100PBP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of S100 BP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for S100PBP

Target: S100PBP (S100P Binding Protein (S100PBP))

Alternative Name: S100PBP

Background: The function of S100PBP protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 37 kDa (MW of target protein)