KRTAP23-1 antibody (Middle Region)

Catalog No. ABIN633028

This Rabbit Polyclonal antibody specifically detects KRTAP23-1 in WB. It exhibits reactivity toward Human.

Quick Overview for KRTAP23-1 antibody (Middle Region) (ABIN633028)

Target: KRTAP23-1 (Keratin Associated Protein 23-1 (KRTAP23-1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KRTAP23-1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KRTAP23-1 Antibody

Binding Specificity: Middle Region

Specificity: KAP23.1 antibody was raised against the middle region of KRTAP23-1

Purification: Affinity purified

Immunogen: KAP23.1 antibody was raised using the middle region of KRTAP23-1 corresponding to a region with amino acids CEGYLCYSGYSRGGSSYPSNLVYSTEPLISQHLPAGFLSLQGLSGDLLGN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KAP23.1 Blocking Peptide, (ABIN937062), is also available for use as a blocking control in assays to test for specificity of this KAP23.1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRTAP23-1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KRTAP23-1

Target: KRTAP23-1 (Keratin Associated Protein 23-1 (KRTAP23-1))

Alternative Name: KAP23.1

Background: In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Molecular Weight: 7 kDa (MW of target protein)