KLHL2 antibody

Catalog No. ABIN633041

The Rabbit Polyclonal anti-KLHL2 antibody has been validated for WB. It is suitable to detect KLHL2 in samples from Human.

Quick Overview for KLHL2 antibody (ABIN633041)

Target: KLHL2 (Kelch-Like 2, Mayven (KLHL2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KLHL2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KLHL2 Antibody

Purification: Affinity purified

Immunogen: KLHL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYAEQHFADVVLSEEFLNLGIEQVCSLISSDKLTISSEEKVFEAVIAWVN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KLHL2 Blocking Peptide, (ABIN5614378), is also available for use as a blocking control in assays to test for specificity of this KLHL2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KLHL2

Target: KLHL2 (Kelch-Like 2, Mayven (KLHL2))

Alternative Name: KLHL2

Background: KLHL2 may play a role in organizing the actin cytoskeleton of the brain cells.

Molecular Weight: 66 kDa (MW of target protein)