NXPH3 antibody (Middle Region)

Catalog No. ABIN633044

The Rabbit Polyclonal anti-NXPH3 antibody has been validated for WB. It is suitable to detect NXPH3 in samples from Human.

Quick Overview for NXPH3 antibody (Middle Region) (ABIN633044)

Target: NXPH3 (Neurexophilin 3 (NXPH3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NXPH3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NXPH3 Antibody

Binding Specificity: Middle Region

Specificity: Neurexophilin 3 antibody was raised against the middle region of NXPH3

Purification: Affinity purified

Immunogen: Neurexophilin 3 antibody was raised using the middle region of NXPH3 corresponding to a region with amino acids NISISLVPPSKAVEFHQEQQIFIEAKASKIFNCRMEWEKVERGRRTSLCT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Neurexophilin 3 Blocking Peptide, (ABIN5614965), is also available for use as a blocking control in assays to test for specificity of this Neurexophilin 3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NXPH3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NXPH3

Target: NXPH3 (Neurexophilin 3 (NXPH3))

Alternative Name: Neurexophilin 3

Background: NXPH3 may be signaling molecules that resemble neuropeptides. Ligand for alpha-neurexins.

Molecular Weight: 28 kDa (MW of target protein)