SCG2 antibody

Catalog No. ABIN633054

The Rabbit Polyclonal anti-SCG2 antibody (ABIN633054) specifically detects SCG2 in WB. The antibody is reactive with Human samples.

Quick Overview for SCG2 antibody (ABIN633054)

Target: SCG2 (Secretogranin II (SCG2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SCG2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SCG2 Antibody

Purification: Affinity purified

Immunogen: SCG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KEESSPDYNPYQGVSVPLQQKENGDESHLPERDSLSEEDWMRIILEALRQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SCG2 Blocking Peptide, (ABIN939716), is also available for use as a blocking control in assays to test for specificity of this SCG2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SCG2

Target: SCG2 (Secretogranin II (SCG2))

Alternative Name: SCG2

Background: The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. Studies in rodents suggest that the full-length protein, secretogranin II, is involved in the packaging or sorting of peptide hormones and neuropeptides into secretory vesicles. The full-length protein is cleaved to produce the active peptide secretoneurin, which exerts chemotaxic effects on specific cell types, and EM66, whose function is unknown.

Molecular Weight: 71 kDa (MW of target protein)