PIGL antibody (N-Term)
-
- Target See all PIGL Antibodies
- PIGL (Phosphatidylinositol Glycan L (PIGL))
-
Binding Specificity
- N-Term
- Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PIGL antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PIGL antibody was raised against the N terminal of PIGL
- Purification
- Affinity purified
- Immunogen
- PIGL antibody was raised using the N terminal of PIGL corresponding to a region with amino acids MEAMWLLCVALAVLAWGFLWVWDSSERMKSREQGGRLGAESRTLLVIAHP
- Top Product
- Discover our top product PIGL Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PIGL Blocking Peptide, catalog no. 33R-5892, is also available for use as a blocking control in assays to test for specificity of this PIGL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PIGL (Phosphatidylinositol Glycan L (PIGL))
- Alternative Name
- PIGL (PIGL Products)
- Synonyms
- CHIME antibody, Gm737 antibody, phosphatidylinositol glycan anchor biosynthesis class L antibody, phosphatidylinositol glycan anchor biosynthesis, class L antibody, PIGL antibody, Pigl antibody
- Background
- This gene encodes an enzyme that catalyzes the second step of glycosylphosphatidylinositol (GPI) biosynthesis, which is the de-N-acetylation of N-acetylglucosaminylphosphatidylinositol (GlcNAc-PI). Study of a similar rat enzyme suggests that this protein localizes to the endoplasmic reticulum.
- Molecular Weight
- 28 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process
-