TMPRSS4 antibody (Middle Region)

Catalog No. ABIN633060

Product Details anti-TMPRSS4 Antibody

Target: TMPRSS4 (Transmembrane Protease, serine 4 (TMPRSS4))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMPRSS4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMPRSS4 antibody was raised against the middle region of TMPRSS4

Purification: Affinity purified

Immunogen: TMPRSS4 antibody was raised using the middle region of TMPRSS4 corresponding to a region with amino acids LSGSLVSLHCLACGKSLKTPRVVGGEEASVDSWPWQVSIQYDKQHVCGGS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMPRSS4 Blocking Peptide, catalog no. 33R-5428, is also available for use as a blocking control in assays to test for specificity of this TMPRSS4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPRSS4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMPRSS4

Target: TMPRSS4 (Transmembrane Protease, serine 4 (TMPRSS4))

Alternative Name: TMPRSS4 (TMPRSS4 Products)

Synonyms: tmprss4 antibody, zgc:152909 antibody, CAPH2 antibody, MT-SP2 antibody, TMPRSS3 antibody, mCAP2 antibody, transmembrane protease, serine 4 antibody, transmembrane protease, serine 4a antibody, TMPRSS4 antibody, tmprss4a antibody, Tmprss4 antibody

Background: This gene encodes a member of the serine protease family. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified as a gene overexpressed in pancreatic carcinoma. The encoded protein is membrane bound with a N-terminal anchor sequence and a glycosylated extracellular region containing the serine protease domain. Multiple transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 48 kDa (MW of target protein)