UGGT1 antibody (Middle Region)

Catalog No. ABIN633063

This anti-UGGT1 antibody is a Rabbit Polyclonal antibody detecting UGGT1 in WB. Suitable for Human.

Quick Overview for UGGT1 antibody (Middle Region) (ABIN633063)

Target: UGGT1 (UDP-Glucose Glycoprotein Glucosyltransferase 1 (UGGT1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UGGT1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-UGGT1 Antibody

Binding Specificity: Middle Region

Specificity: UGCGL1 antibody was raised against the middle region of µgCGL1

Purification: Affinity purified

Immunogen: UGCGL1 antibody was raised using the middle region of µgCGL1 corresponding to a region with amino acids AAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UGCGL1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this µgCGL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgCGL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UGGT1

Target: UGGT1 (UDP-Glucose Glycoprotein Glucosyltransferase 1 (UGGT1))

Alternative Name: UGCGL1

Background: UDP-glucose:glycoprotein glucosyltransferase (UGT) is a soluble protein of the endoplasmic reticulum (ER) that selectively reglucosylates unfolded glycoproteins, thus providing quality control for protein transport out of the ER.

Molecular Weight: 175 kDa (MW of target protein)

Pathways: Activation of Innate immune Response