EXOC8 antibody (N-Term)

Catalog No. ABIN633065

The Rabbit Polyclonal anti-EXOC8 antibody has been validated for WB. It is suitable to detect EXOC8 in samples from Human.

Quick Overview for EXOC8 antibody (N-Term) (ABIN633065)

Target: EXOC8 (EXO84) (Exocyst Complex Component 8 (EXO84))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EXOC8 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-EXOC8 Antibody

Binding Specificity: N-Term

Specificity: EXOC8 antibody was raised against the N terminal of EXOC8

Purification: Affinity purified

Immunogen: EXOC8 antibody was raised using the N terminal of EXOC8 corresponding to a region with amino acids MAMAMSDSGASRLRRQLESGGFEARLYVKQLSQQSDGDRDLQEHRQRIQA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EXOC8 Blocking Peptide, (ABIN5613430), is also available for use as a blocking control in assays to test for specificity of this EXOC8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOC8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EXOC8

Target: EXOC8 (EXO84) (Exocyst Complex Component 8 (EXO84))

Alternative Name: EXOC8

Background: EXOC8 is the component of the exocyst complex involved in the docking of exocystic vesicles with fusion sites on the plasma membrane.

Molecular Weight: 82 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism