LRG1 antibody (N-Term)

Catalog No. ABIN633085

This Rabbit Polyclonal antibody specifically detects LRG1 in WB. It exhibits reactivity toward Human.

Quick Overview for LRG1 antibody (N-Term) (ABIN633085)

Target: LRG1 (Leucine-Rich alpha-2 Glycoprotein 1 (LRG1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRG1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LRG1 Antibody

Binding Specificity: N-Term

Specificity: LRG1 antibody was raised against the N terminal of LRG1

Purification: Affinity purified

Immunogen: LRG1 antibody was raised using the N terminal of LRG1 corresponding to a region with amino acids GVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRG1 Blocking Peptide, (ABIN939043), is also available for use as a blocking control in assays to test for specificity of this LRG1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRG1

Target: LRG1 (Leucine-Rich alpha-2 Glycoprotein 1 (LRG1))

Alternative Name: LRG1

Background: The leucine-rich repeat (LRR) family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation.

Molecular Weight: 38 kDa (MW of target protein)

Pathways: Brown Fat Cell Differentiation