CCDC76 antibody (N-Term)

Catalog No. ABIN633095

The Rabbit Polyclonal anti-CCDC76 antibody has been validated for WB. It is suitable to detect CCDC76 in samples from Human.

Quick Overview for CCDC76 antibody (N-Term) (ABIN633095)

Target: CCDC76 (Coiled-Coil Domain Containing 76 (CCDC76))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCDC76 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CCDC76 Antibody

Binding Specificity: N-Term

Specificity: CCDC76 antibody was raised against the N terminal of CCDC76

Purification: Affinity purified

Immunogen: CCDC76 antibody was raised using the N terminal of CCDC76 corresponding to a region with amino acids QLAKHLKKCNSREKPKPDFYIQDINAGLRDETEIPEQLVPISSLSEEQLE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CCDC76 Blocking Peptide, (ABIN5612716), is also available for use as a blocking control in assays to test for specificity of this CCDC76 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC76 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CCDC76

Target: CCDC76 (Coiled-Coil Domain Containing 76 (CCDC76))

Alternative Name: CCDC76

Background: CCDC76 specifically methylates guanosine-4 in various tRNAs with a Gly(CCG), His or Pro signature.

Molecular Weight: 54 kDa (MW of target protein)