CCDC76 antibody (N-Term)
-
- Target See all CCDC76 Antibodies
- CCDC76 (Coiled-Coil Domain Containing 76 (CCDC76))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CCDC76 antibody is un-conjugated
- Application
- Western Blotting (WB)
- Specificity
- CCDC76 antibody was raised against the N terminal of CCDC76
- Purification
- Affinity purified
- Immunogen
- CCDC76 antibody was raised using the N terminal of CCDC76 corresponding to a region with amino acids QLAKHLKKCNSREKPKPDFYIQDINAGLRDETEIPEQLVPISSLSEEQLE
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CCDC76 Blocking Peptide, catalog no. 33R-7618, is also available for use as a blocking control in assays to test for specificity of this CCDC76 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC76 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CCDC76 (Coiled-Coil Domain Containing 76 (CCDC76))
- Alternative Name
- CCDC76 (CCDC76 Products)
- Background
- CCDC76 specifically methylates guanosine-4 in various tRNAs with a Gly(CCG), His or Pro signature.
- Molecular Weight
- 54 kDa (MW of target protein)
-