FTO antibody (Middle Region)

Catalog No. ABIN633096

Product Details anti-FTO Antibody

Target: FTO (Fat Mass and Obesity-Associated (FTO))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FTO antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FTO antibody was raised against the middle region of FTO

Purification: Affinity purified

Immunogen: FTO antibody was raised using the middle region of FTO corresponding to a region with amino acids WWCQPMAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FTO Blocking Peptide, catalog no. 33R-10037, is also available for use as a blocking control in assays to test for specificity of this FTO antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FTO antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FTO

Target: FTO (Fat Mass and Obesity-Associated (FTO))

Alternative Name: FTO (FTO Products)

Synonyms: AW743446 antibody, mKIAA1752 antibody, RGD1305121 antibody, FTO, alpha-ketoglutarate dependent dioxygenase antibody, fat mass and obesity associated antibody, fat mass and obesity associated L homeolog antibody, FTO antibody, Fto antibody, fto.L antibody

Background: The exact function of this gene is not known. Studies in mice suggest that it may be involved in nucleic acid demethylation, and that its mRNA level is regulated by feeding and fasting. Genomewide association studies of type 2 diabetes indicate this gene as a diabetes susceptibility locus. Mutation in this gene has been associated with growth retardation, developmental delay, coarse facies, and early death.

Molecular Weight: 58 kDa (MW of target protein)