Glycerol Kinase antibody (Middle Region)
-
- Target See all Glycerol Kinase (GK) Antibodies
- Glycerol Kinase (GK)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Glycerol Kinase antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GK antibody was raised against the middle region of GK
- Purification
- Affinity purified
- Immunogen
- GK antibody was raised using the middle region of GK corresponding to a region with amino acids MAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKS
- Top Product
- Discover our top product GK Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GK Blocking Peptide, catalog no. 33R-5595, is also available for use as a blocking control in assays to test for specificity of this GK antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GK antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Glycerol Kinase (GK)
- Alternative Name
- GK (GK Products)
- Synonyms
- GK1 antibody, GKD antibody, D930012N15Rik antibody, GK antibody, CG18374 antibody, Dmel\\CG18374 antibody, dGyk antibody, ASTP antibody, Gyk antibody, gk1 antibody, gk2 antibody, gkd antibody, gyk antibody, Gk antibody, BmGK antibody, DKFZp469P1225 antibody, glycerol kinase antibody, Glycerol kinase 1 antibody, glycerol kinase S homeolog antibody, putative glycerol kinase 3 antibody, ATP:glycerol 3-phosphotransferase; glycerokinase; GK antibody, Glycerol kinase antibody, Fanconi anemia core complex associated protein 100 antibody, GK antibody, Gk antibody, Gk1 antibody, gk.S antibody, LOC705001 antibody, glpK antibody, Spico_1557 antibody, Trebr_0397 antibody, Halhy_5315 antibody, gk antibody, FAAP100 antibody
- Background
- The product of this gene belongs to the FGGY kinase family of proteins and encodes glycerol kinase. Glycerol kinase is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Defects in this gene are the cause of glycerol kinase deficiency (GkDa). Alternatively spliced transcript variants encoding different isoforms have been identified.
- Molecular Weight
- 58 kDa (MW of target protein)
-