Glycerol Kinase antibody (Middle Region)

Catalog No. ABIN633106

Product Details anti-Glycerol Kinase Antibody

Target: Glycerol Kinase (GK)

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Glycerol Kinase antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GK antibody was raised against the middle region of GK

Purification: Affinity purified

Immunogen: GK antibody was raised using the middle region of GK corresponding to a region with amino acids MAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GK Blocking Peptide, catalog no. 33R-5595, is also available for use as a blocking control in assays to test for specificity of this GK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Glycerol Kinase

Target: Glycerol Kinase (GK)

Alternative Name: GK (GK Products)

Synonyms: GK1 antibody, GKD antibody, D930012N15Rik antibody, GK antibody, CG18374 antibody, Dmel\\CG18374 antibody, dGyk antibody, ASTP antibody, Gyk antibody, gk1 antibody, gk2 antibody, gkd antibody, gyk antibody, Gk antibody, BmGK antibody, DKFZp469P1225 antibody, glycerol kinase antibody, Glycerol kinase 1 antibody, glycerol kinase S homeolog antibody, putative glycerol kinase 3 antibody, ATP:glycerol 3-phosphotransferase; glycerokinase; GK antibody, Glycerol kinase antibody, Fanconi anemia core complex associated protein 100 antibody, GK antibody, Gk antibody, Gk1 antibody, gk.S antibody, LOC705001 antibody, glpK antibody, Spico_1557 antibody, Trebr_0397 antibody, Halhy_5315 antibody, gk antibody, FAAP100 antibody

Background: The product of this gene belongs to the FGGY kinase family of proteins and encodes glycerol kinase. Glycerol kinase is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Defects in this gene are the cause of glycerol kinase deficiency (GkDa). Alternatively spliced transcript variants encoding different isoforms have been identified.

Molecular Weight: 58 kDa (MW of target protein)