ARHGEF19 antibody

Catalog No. ABIN633111

This anti-ARHGEF19 antibody is a Rabbit Polyclonal antibody detecting ARHGEF19 in WB. Suitable for Human.

Quick Overview for ARHGEF19 antibody (ABIN633111)

Target: ARHGEF19 (rho Guanine Nucleotide Exchange Factor (GEF) 19 (ARHGEF19))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ARHGEF19 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ARHGEF19 Antibody

Purification: Affinity purified

Immunogen: ARHGEF19 antibody was raised using a synthetic peptide corresponding to a region with amino acids RFLLNSVLYQEYSDVASARELRRQQREEEGPGDEAEGAEEGPGPPRANLS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARHGEF19 Blocking Peptide, (ABIN5612151), is also available for use as a blocking control in assays to test for specificity of this ARHGEF19 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARHGEF19 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ARHGEF19

Target: ARHGEF19 (rho Guanine Nucleotide Exchange Factor (GEF) 19 (ARHGEF19))

Alternative Name: ARHGEF19

Background: Guanine nucleotide exchange factors (GEFs) such as ARHGEF19 accelerate the GTPase activity of Rho GTPases.

Molecular Weight: 89 kDa (MW of target protein)