C19orf18 antibody (N-Term)

Catalog No. ABIN633114

The Rabbit Polyclonal anti-C19orf18 antibody (ABIN633114) specifically detects C19orf18 in WB. The antibody is reactive with Human samples.

Quick Overview for C19orf18 antibody (N-Term) (ABIN633114)

Target: C19orf18 (Chromosome 19 Open Reading Frame 18 (C19orf18))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C19orf18 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-C19orf18 Antibody

Binding Specificity: N-Term

Specificity: C19 orf18 antibody was raised against the N terminal of C19 rf18

Purification: Affinity purified

Immunogen: C19 orf18 antibody was raised using the N terminal of C19 rf18 corresponding to a region with amino acids NITGLPGSKRSQPPRNITKEPKVFFHKTQLPGIQGAASRSTAASPTNPMK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C19orf18 Blocking Peptide, (ABIN5612438), is also available for use as a blocking control in assays to test for specificity of this C19orf18 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 rf18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C19orf18

Target: C19orf18 (Chromosome 19 Open Reading Frame 18 (C19orf18))

Alternative Name: C19orf18

Background: The function of Chromosome 19 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 24 kDa (MW of target protein)