TACC3 antibody (Middle Region)
-
- Target See all TACC3 Antibodies
- TACC3 (Transforming, Acidic Coiled-Coil Containing Protein 3 (TACC3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TACC3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TACC3 antibody was raised against the middle region of TACC3
- Purification
- Affinity purified
- Immunogen
- TACC3 antibody was raised using the middle region of TACC3 corresponding to a region with amino acids PGSEPVPTHQQGQPALELKEESFRDPAEVLGTGAEVDYLEQFGTSSFKES
- Top Product
- Discover our top product TACC3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TACC3 Blocking Peptide, catalog no. 33R-7132, is also available for use as a blocking control in assays to test for specificity of this TACC3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TACC3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TACC3 (Transforming, Acidic Coiled-Coil Containing Protein 3 (TACC3))
- Alternative Name
- TACC3 (TACC3 Products)
- Background
- The function of this gene has not yet been determined, however, it is speculated that it may be involved in cell growth and differentiation. Expression of this gene is up-regulated in some cancer cell lines, and in embryonic day 15 in mice.
- Molecular Weight
- 90 kDa (MW of target protein)
- Pathways
- Maintenance of Protein Location
-