TACC3 antibody (Middle Region)

Catalog No. ABIN633120

This anti-TACC3 antibody is a Rabbit Polyclonal antibody detecting TACC3 in WB. Suitable for Human.

Quick Overview for TACC3 antibody (Middle Region) (ABIN633120)

Target: TACC3 (Transforming, Acidic Coiled-Coil Containing Protein 3 (TACC3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TACC3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TACC3 Antibody

Binding Specificity: Middle Region

Specificity: TACC3 antibody was raised against the middle region of TACC3

Purification: Affinity purified

Immunogen: TACC3 antibody was raised using the middle region of TACC3 corresponding to a region with amino acids PGSEPVPTHQQGQPALELKEESFRDPAEVLGTGAEVDYLEQFGTSSFKES

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TACC3 Blocking Peptide, (ABIN5616492), is also available for use as a blocking control in assays to test for specificity of this TACC3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TACC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TACC3

Target: TACC3 (Transforming, Acidic Coiled-Coil Containing Protein 3 (TACC3))

Alternative Name: TACC3

Background: The function of this gene has not yet been determined, however, it is speculated that it may be involved in cell growth and differentiation. Expression of this gene is up-regulated in some cancer cell lines, and in embryonic day 15 in mice.

Molecular Weight: 90 kDa (MW of target protein)

Pathways: Maintenance of Protein Location