ANKRD54 antibody (Middle Region)

Catalog No. ABIN633128

Product Details anti-ANKRD54 Antibody

Target: ANKRD54 (Ankyrin Repeat Domain 54 (ANKRD54))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ANKRD54 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ANKRD54 antibody was raised against the middle region of ANKRD54

Purification: Affinity purified

Immunogen: ANKRD54 antibody was raised using the middle region of ANKRD54 corresponding to a region with amino acids EVHALKRLRDSANANDVETVQQLLEDGADPCAADDKGRTALHFASCNGND

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ANKRD54 Blocking Peptide, catalog no. 33R-2788, is also available for use as a blocking control in assays to test for specificity of this ANKRD54 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKRD54 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ANKRD54

Target: ANKRD54 (Ankyrin Repeat Domain 54 (ANKRD54))

Alternative Name: ANKRD54 (ANKRD54 Products)

Synonyms: LIAR antibody, C730048E16Rik antibody, EST1068184 antibody, EST475269 antibody, Liar antibody, RGD1309552 antibody, wu:fi33d09 antibody, zgc:110569 antibody, zgc:92735 antibody, ankyrin repeat domain 54 antibody, ANKRD54 antibody, Ankrd54 antibody, ankrd54 antibody

Background: ANKRD54 is involved in protein complex binding and protein kinase regulator activity.

Molecular Weight: 32 kDa (MW of target protein)