MAGEA5 antibody (N-Term)

Catalog No. ABIN633132

This anti-MAGEA5 antibody is a Rabbit Polyclonal antibody detecting MAGEA5 in WB. Suitable for Human.

Quick Overview for MAGEA5 antibody (N-Term) (ABIN633132)

Target: MAGEA5 (Melanoma Antigen Family A, 5 (MAGEA5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAGEA5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MAGEA5 Antibody

Binding Specificity: N-Term

Specificity: MAGEA5 antibody was raised against the N terminal of MAGEA5

Purification: Affinity purified

Immunogen: MAGEA5 antibody was raised using the N terminal of MAGEA5 corresponding to a region with amino acids MSLEQKSQHCKPEEGLDTQEEALGLVGVQAATTEEQEAVSSSSPLVPGTL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAGEA5 Blocking Peptide, (ABIN5614631), is also available for use as a blocking control in assays to test for specificity of this MAGEA5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAGEA5

Target: MAGEA5 (Melanoma Antigen Family A, 5 (MAGEA5))

Alternative Name: MAGEA5

Background: This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. This MAGEA gene encodes a protein that is C-terminally truncated compared to other family members, and this gene can be alternatively interpreted to be a pseudogene. The protein is represented in this Entrez Gene record in accordance with the assumed protein-coding status defined in the literature.

Molecular Weight: 13 kDa (MW of target protein)