FAM3D antibody (Middle Region)

Catalog No. ABIN633145

Product Details anti-FAM3D Antibody

Target: FAM3D (Family with Sequence Similarity 3, Member D (FAM3D))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM3D antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM3 D antibody was raised against the middle region of FAM3

Purification: Affinity purified

Immunogen: FAM3 D antibody was raised using the middle region of FAM3 corresponding to a region with amino acids LVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVFIGAKDLRGKSP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM3D Blocking Peptide, catalog no. 33R-5499, is also available for use as a blocking control in assays to test for specificity of this FAM3D antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM3D

Target: FAM3D (Family with Sequence Similarity 3, Member D (FAM3D))

Alternative Name: FAM3D (FAM3D Products)

Background: The function of FAM3 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 25 kDa (MW of target protein)