UNQ1887 (Middle Region) antibody

Catalog No. ABIN633151

This Rabbit Polyclonal antibody specifically detects UNQ1887 in WB. It exhibits reactivity toward Human.

Quick Overview for UNQ1887 (Middle Region) antibody (ABIN633151)

Target: UNQ1887

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Product Details

Binding Specificity: Middle Region

Specificity: UNQ1887 antibody was raised against the middle region of UNQ1887

Purification: Affinity purified

Immunogen: UNQ1887 antibody was raised using the middle region of UNQ1887 corresponding to a region with amino acids VMVKVATQPADNPLDVLSRKLHLGPNVGRDVPRLSLPGKLVFPSSTGSHF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UNQ1887 Blocking Peptide, (ABIN5616916), is also available for use as a blocking control in assays to test for specificity of this UNQ1887 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNQ1887 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: UNQ1887

Background: UNQ1887 may act as intramembrane protease.

Molecular Weight: 42 kDa (MW of target protein)