NRBF2 antibody (N-Term)

Catalog No. ABIN633155

The Rabbit Polyclonal anti-NRBF2 antibody has been validated for WB. It is suitable to detect NRBF2 in samples from Human.

Quick Overview for NRBF2 antibody (N-Term) (ABIN633155)

Target: NRBF2 (Nuclear Receptor Binding Factor 2 (NRBF2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NRBF2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NRBF2 Antibody

Binding Specificity: N-Term

Specificity: NRBF2 antibody was raised against the N terminal of NRBF2

Purification: Affinity purified

Immunogen: NRBF2 antibody was raised using the N terminal of NRBF2 corresponding to a region with amino acids KKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NRBF2 Blocking Peptide, (ABIN939834), is also available for use as a blocking control in assays to test for specificity of this NRBF2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRBF2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NRBF2

Target: NRBF2 (Nuclear Receptor Binding Factor 2 (NRBF2))

Alternative Name: NRBF2

Background: NRBF2 may modulate transcriptional activation by target nuclear receptors.

Molecular Weight: 32 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway