TDRD9 antibody (Middle Region)

Catalog No. ABIN633194

The Rabbit Polyclonal anti-TDRD9 antibody is suitable to detect TDRD9 in samples from Human. It has been validated for WB.

Quick Overview for TDRD9 antibody (Middle Region) (ABIN633194)

Target: TDRD9 (Tudor Domain Containing 9 (TDRD9))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TDRD9 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TDRD9 Antibody

Binding Specificity: Middle Region

Specificity: TDRD9 antibody was raised against the middle region of TDRD9

Purification: Affinity purified

Immunogen: TDRD9 antibody was raised using the middle region of TDRD9 corresponding to a region with amino acids AINIRDVLIQQGYAELTEESYESKQSHEVLKGLFSKSVENMTDGSVPFPM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TDRD9 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this TDRD9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TDRD9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TDRD9

Target: TDRD9 (Tudor Domain Containing 9 (TDRD9))

Alternative Name: TDRD9

Background: TDRD9 contains 1 helicase ATP-binding domain and 1 helicase C-terminal domain. The exact function of TDRD9 is not known.

Molecular Weight: 103 kDa (MW of target protein)