XPO1 antibody

Catalog No. ABIN633201

This anti-XPO1 antibody is a Rabbit Polyclonal antibody detecting XPO1 in WB. Suitable for Human.

Quick Overview for XPO1 antibody (ABIN633201)

Target: XPO1 (Exportin 1 (XPO1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This XPO1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-XPO1 Antibody

Purification: Affinity purified

Immunogen: XPO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids IPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

XPO1 Blocking Peptide, (ABIN939472), is also available for use as a blocking control in assays to test for specificity of this XPO1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XPO1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for XPO1

Target: XPO1 (Exportin 1 (XPO1))

Alternative Name: XPO1

Background: XPO1 mediates leucine-rich nuclear export signal (NES)-dependent protein transport. Exportin 1 specifically inhibits the nuclear export of Rev and U snRNAs. It is also involved in the control of several cellular processes by controlling the localization of cyclin B, MPAK, and MAPKAP kinase 2. This protein also regulates NFAT and AP-1.

Molecular Weight: 123 kDa (MW of target protein)

Pathways: M Phase