RPL5 antibody (N-Term)

Catalog No. ABIN633202

This Rabbit Polyclonal antibody specifically detects RPL5 in WB. It exhibits reactivity toward Human, Mouse, Rat, Drosophila melanogaster and Arabidopsis.

Quick Overview for RPL5 antibody (N-Term) (ABIN633202)

Target: RPL5 (Ribosomal Protein L5 (RPL5))

Reactivity: Human, Mouse, Rat, Drosophila melanogaster, Arabidopsis

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPL5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RPL5 Antibody

Binding Specificity: N-Term

Specificity: RPL5 antibody was raised against the N terminal of RPL5

Purification: Affinity purified

Immunogen: RPL5 antibody was raised using the N terminal of RPL5 corresponding to a region with amino acids RLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPL5 Blocking Peptide, (ABIN5615941), is also available for use as a blocking control in assays to test for specificity of this RPL5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPL5

Target: RPL5 (Ribosomal Protein L5 (RPL5))

Alternative Name: RPL5

Background: RPL5 is required for rRNA maturation and formation of the 60S ribosomal subunits. This protein binds 5S RNA.

Molecular Weight: 34 kDa (MW of target protein)