RAVER2 antibody (Middle Region)

Catalog No. ABIN633210

Product Details anti-RAVER2 Antibody

Target: RAVER2 (Ribonucleoprotein, PTB-Binding 2 (RAVER2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAVER2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RAVER2 antibody was raised against the middle region of RAVER2

Purification: Affinity purified

Immunogen: RAVER2 antibody was raised using the middle region of RAVER2 corresponding to a region with amino acids TITAGMGMLPFFPNQHIAGQAGPGHSNTQEKQPATVGMAEGNFSGSQPYL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAVER2 Blocking Peptide, catalog no. 33R-9130, is also available for use as a blocking control in assays to test for specificity of this RAVER2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAVER2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAVER2

Target: RAVER2 (Ribonucleoprotein, PTB-Binding 2 (RAVER2))

Alternative Name: RAVER2 (RAVER2 Products)

Synonyms: A430091O22Rik antibody, ribonucleoprotein, PTB binding 2 antibody, ribonucleoprotein, PTB-binding 2 antibody, RAVER2 antibody, Raver2 antibody

Background: RAVER2 may bind single stranded nucleic acids.

Molecular Weight: 73 kDa (MW of target protein)