HNRNPA2B1 antibody (N-Term)

Catalog No. ABIN633233

The Rabbit Polyclonal anti-HNRNPA2B1 antibody has been validated for WB. It is suitable to detect HNRNPA2B1 in samples from Human and Rat.

Quick Overview for HNRNPA2B1 antibody (N-Term) (ABIN633233)

Target: HNRNPA2B1 (Heterogeneous Nuclear Ribonucleoprotein A2/B1 (HNRNPA2B1))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HNRNPA2B1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HNRNPA2B1 Antibody

Binding Specificity: N-Term

Specificity: HNRNPA2 B1 antibody was raised against the N terminal of HNRNPA2 1

Purification: Affinity purified

Immunogen: HNRNPA2 B1 antibody was raised using the N terminal of HNRNPA2 1 corresponding to a region with amino acids MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDC

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HNRNPA2B1 Blocking Peptide, catalog no. 33R-5932, is also available for use as a blocking control in assays to test for specificity of this HNRNPA2B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRNPA0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HNRNPA2B1

Target: HNRNPA2B1 (Heterogeneous Nuclear Ribonucleoprotein A2/B1 (HNRNPA2B1))

Alternative Name: HNRNPA2B1

Background: HNRNPA2B1 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm.

Molecular Weight: 37 kDa (MW of target protein)