HNRNPAB antibody (N-Term)

Catalog No. ABIN633238

This Rabbit Polyclonal antibody specifically detects HNRNPAB in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for HNRNPAB antibody (N-Term) (ABIN633238)

Target: HNRNPAB (Heterogeneous Nuclear Ribonucleoprotein A/B (HNRNPAB))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HNRNPAB antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HNRNPAB Antibody

Binding Specificity: N-Term

Specificity: HNRPAB antibody was raised against the N terminal Of Hnrpab

Purification: Affinity purified

Immunogen: HNRPAB antibody was raised using the N terminal Of Hnrpab corresponding to a region with amino acids GAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HNRPAB Blocking Peptide, (ABIN938530), is also available for use as a blocking control in assays to test for specificity of this HNRPAB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPAB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HNRNPAB

Target: HNRNPAB (Heterogeneous Nuclear Ribonucleoprotein A/B (HNRNPAB))

Alternative Name: HNRPAB

Background: This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are produced by RNA polymerase II and are components of the heterogeneous nuclear RNA (hnRNA) complexes.

Molecular Weight: 36 kDa (MW of target protein)