SNRPD2 antibody (N-Term)

Catalog No. ABIN633239

Product Details anti-SNRPD2 Antibody

Target: SNRPD2 (Small Nuclear Ribonucleoprotein D2 Polypeptide 16.5kDa (SNRPD2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SNRPD2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SNRPD2 antibody was raised against the N terminal of SNRPD2

Purification: Affinity purified

Immunogen: SNRPD2 antibody was raised using the N terminal of SNRPD2 corresponding to a region with amino acids MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SNRPD2 Blocking Peptide, catalog no. 33R-6463, is also available for use as a blocking control in assays to test for specificity of this SNRPD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SNRPD2

Target: SNRPD2 (Small Nuclear Ribonucleoprotein D2 Polypeptide 16.5kDa (SNRPD2))

Alternative Name: SNRPD2 (SNRPD2 Products)

Background: SNRPD2 belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 13 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization