XPOT antibody

Catalog No. ABIN633241

This Rabbit Polyclonal antibody specifically detects XPOT in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for XPOT antibody (ABIN633241)

Target: XPOT (Exportin, tRNA (Nuclear Export Receptor For TRNAs) (XPOT))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This XPOT antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-XPOT Antibody

Purification: Affinity purified

Immunogen: XPOT antibody was raised using a synthetic peptide corresponding to a region with amino acids TVLSDQQKANVEAIMLAVMKKLTYDEEYNFENEGEDEAMFVEYRKQLKLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

XPOT Blocking Peptide, (ABIN5617045), is also available for use as a blocking control in assays to test for specificity of this XPOT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XPOT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for XPOT

Target: XPOT (Exportin, tRNA (Nuclear Export Receptor For TRNAs) (XPOT))

Alternative Name: XPOT

Background: XPOT belonging to the RAN-GTPase exportin family that mediates export of tRNA from the nucleus to the cytoplasm. Translocation of tRNA to the cytoplasm occurs once exportin has bound both tRNA and GTP-bound RAN.

Molecular Weight: 110 kDa (MW of target protein)