DIS3 antibody

Catalog No. ABIN633251

Product Details anti-DIS3 Antibody

Target: DIS3 (Exosome Complex Exonuclease RRP44 (DIS3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DIS3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DIS3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DIVAVELLPKSQWVAPSSVVLHDEGQNEEDVEKEEETERMLKTAVSEKML

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DIS3 Blocking Peptide, catalog no. 33R-2010, is also available for use as a blocking control in assays to test for specificity of this DIS3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DIS3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DIS3

Target: DIS3 (Exosome Complex Exonuclease RRP44 (DIS3))

Alternative Name: DIS3 (DIS3 Products)

Background: DIS3, belonging to the ribonuclease II (RNB) family, has a 3'-5' exonuclease activity. It is a catalytic component of the exosome 3'->5' exoribonuclease complex required for the 3'-processing of the 7S pre-RNA to the mature 5.8S rRNA and for mRNA decay. The protein is implicated in mitotic control and essential for cell division and spore germination. It may be involved in regulating protein dephosphorylation during mitosis.

Molecular Weight: 109 kDa (MW of target protein)