EIF4E antibody (C-Term)

Catalog No. ABIN633255

This anti-EIF4E antibody is a Rabbit Polyclonal antibody detecting EIF4E in WB. Suitable for Human, Rat and Mouse.

Quick Overview for EIF4E antibody (C-Term) (ABIN633255)

Target: EIF4E (Eukaryotic Translation Initiation Factor 4E (EIF4E))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EIF4E antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-EIF4E Antibody

Binding Specificity: C-Term

Specificity: EIF4 E antibody was raised against the C terminal of EIF4

Purification: Affinity purified

Immunogen: EIF4 E antibody was raised using the C terminal of EIF4 corresponding to a region with amino acids TECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EIF4E Blocking Peptide, (ABIN5613341), is also available for use as a blocking control in assays to test for specificity of this EIF4E antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EIF4E

Target: EIF4E (Eukaryotic Translation Initiation Factor 4E (EIF4E))

Alternative Name: EIF4E

Background: All eukaryotic cellular mRNAs are blocked at their 5-prime ends with the 7-methylguanosine cap structure, m7GpppX (where X is any nucleotide). This structure is involved in several cellular processes including enhanced translational efficiency, splicing, mRNA stability, and RNA nuclear export.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: BCR Signaling