RDBP antibody (N-Term)

Catalog No. ABIN633256

This Rabbit Polyclonal antibody specifically detects RDBP in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for RDBP antibody (N-Term) (ABIN633256)

Target: RDBP (RD RNA Binding Protein (RDBP))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RDBP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RDBP Antibody

Binding Specificity: N-Term

Specificity: RDBP antibody was raised against the N terminal of RDBP

Purification: Affinity purified

Immunogen: RDBP antibody was raised using the N terminal of RDBP corresponding to a region with amino acids LVIPPGLSEEEEALQKKFNKLKKKKKALLALKKQSSSSTTSQGGVKRSLS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RDBP Blocking Peptide, (ABIN5615816), is also available for use as a blocking control in assays to test for specificity of this RDBP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDBP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RDBP

Target: RDBP (RD RNA Binding Protein (RDBP))

Alternative Name: RDBP

Background: RDBP is part of a complex termed negative elongation factor (NELF) which represses RNA polymerase II transcript elongation. This protein bears similarity to nuclear RNA-binding proteins, however, it has not been demonstrated that this protein binds RNA. The protein contains a tract of alternating basic and acidic residues, largely arginine (R) and aspartic acid (D).

Molecular Weight: 43 kDa (MW of target protein)