SERBP1 antibody (C-Term)

Catalog No. ABIN633268

Product Details anti-SERBP1 Antibody

Target: SERBP1 (SERPINE1 mRNA Binding Protein 1 (SERBP1))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SERBP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SERBP1 antibody was raised against the C terminal of SERBP1

Purification: Affinity purified

Immunogen: SERBP1 antibody was raised using the C terminal of SERBP1 corresponding to a region with amino acids DRAKVEFNIRKPNEGADGQWKKGFVLHKSKSEEAHAEDSVMDHHFRKPAN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SERBP1 Blocking Peptide, catalog no. 33R-2138, is also available for use as a blocking control in assays to test for specificity of this SERBP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERBP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SERBP1

Target: SERBP1 (SERPINE1 mRNA Binding Protein 1 (SERBP1))

Alternative Name: SERBP1 (SERBP1 Products)

Synonyms: CHD3IP antibody, HABP4L antibody, PAI-RBP1 antibody, PAIRBP1 antibody, 1200009K13Rik antibody, 9330147J08Rik antibody, AL022786 antibody, Pairbp1 antibody, Pai-Rbp1 antibody, Rda288 antibody, cgi-55 antibody, chd3ip antibody, habp4l antibody, pai-rbp1 antibody, pairbp1 antibody, rda288 antibody, hm:zeh0245 antibody, serbp1 antibody, wu:fa12d05 antibody, wu:fb36e07 antibody, wu:fc16f12 antibody, wu:fj13e12 antibody, zgc:55489 antibody, SERPINE1 mRNA binding protein 1 antibody, serpine1 mRNA binding protein 1 antibody, Serpine1 mRNA binding protein 1 antibody, SERPINE1 mRNA binding protein 1 L homeolog antibody, SERPINE1 mRNA binding protein 1a antibody, SERBP1 antibody, Serbp1 antibody, serbp1.L antibody, serbp1a antibody

Background: SERBP1 may play a role in the regulation of mRNA stability. It binds to the 3'-most 134 nt of the SERPINE1/PAI1 mRNA, a region which confers cyclic nucleotide regulation of message decay.

Molecular Weight: 45 kDa (MW of target protein)