KRR1 antibody (C-Term)

Catalog No. ABIN633275

The Rabbit Polyclonal anti-KRR1 antibody has been validated for WB. It is suitable to detect KRR1 in samples from Human.

Quick Overview for KRR1 antibody (C-Term) (ABIN633275)

Target: KRR1 (KRR1, Small Subunit (SSU) Processome Component, Homolog (KRR1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KRR1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KRR1 Antibody

Binding Specificity: C-Term

Specificity: KRR1 antibody was raised against the C terminal of KRR1

Purification: Affinity purified

Immunogen: KRR1 antibody was raised using the C terminal of KRR1 corresponding to a region with amino acids KANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTET

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KRR1 Blocking Peptide, (ABIN939639), is also available for use as a blocking control in assays to test for specificity of this KRR1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KRR1

Target: KRR1 (KRR1, Small Subunit (SSU) Processome Component, Homolog (KRR1))

Alternative Name: KRR1

Background: KRR1 belongs to the KRR1 family. It contains 1 KH domain. KRR1 is required for 40S ribosome biogenesis. It is involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly.

Molecular Weight: 44 kDa (MW of target protein)