Pre-mRNA Branch Site Protein p14 (SF3B14) (Middle Region) antibody

Catalog No. ABIN633280

This Rabbit Polyclonal antibody specifically detects Pre-mRNA Branch Site Protein p14 in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for Pre-mRNA Branch Site Protein p14 (SF3B14) (Middle Region) antibody (ABIN633280)

Target: Pre-mRNA Branch Site Protein p14 (SF3B14)

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Product Details

Binding Specificity: Middle Region

Specificity: SF3 B14 antibody was raised against the middle region of SF3 14

Purification: Affinity purified

Immunogen: SF3 B14 antibody was raised using the middle region of SF3 14 corresponding to a region with amino acids HLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK

Application Details

Application Notes: WB: 2 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SF3B14 Blocking Peptide, (ABIN939174), is also available for use as a blocking control in assays to test for specificity of this SF3B14 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF0 14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Pre-mRNA Branch Site Protein p14 (SF3B14)

Alternative Name: SF3B14

Background: SF3B14 is a 14 kDa protein subunit of the splicing factor 3b complex. Splicing factor 3b associates with both the U2 and U11/U12 small nuclear ribonucleoprotein complexes (U2 snRNP) of spliceosomes. This 14 kDa protein interacts directly with subunit 1 of the splicing factor 3b complex. SF3B14 also interacts directly with the adenosine that carries out the first transesterification step of splicing at the pre-mRNA branch site.

Molecular Weight: 14 kDa (MW of target protein)