RPL3 antibody (C-Term)

Catalog No. ABIN633286

This Rabbit Polyclonal antibody specifically detects RPL3 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for RPL3 antibody (C-Term) (ABIN633286)

Target: RPL3 (Ribosomal Protein L3 (RPL3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPL3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RPL3 Antibody

Binding Specificity: C-Term

Specificity: RPL3 antibody was raised against the C terminal of RPL3

Purification: Affinity purified

Immunogen: RPL3 antibody was raised using the C terminal of RPL3 corresponding to a region with amino acids YHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPL3 Blocking Peptide, catalog no. 33R-10124, is also available for use as a blocking control in assays to test for specificity of this RPL3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPL3

Target: RPL3 (Ribosomal Protein L3 (RPL3))

Alternative Name: RPL3

Background: Ribosomes, the complexes that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL3 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L3P family of ribosomal proteins and it is located in the cytoplasm. The protein can bind to the HIV-1 TAR mRNA, and it has been suggested that the protein contributes to tat-mediated transactivation.

Molecular Weight: 40 kDa (MW of target protein)