RPL3 antibody (C-Term)
-
- Target See all RPL3 Antibodies
- RPL3 (Ribosomal Protein L3 (RPL3))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RPL3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RPL3 antibody was raised against the C terminal of RPL3
- Purification
- Affinity purified
- Immunogen
- RPL3 antibody was raised using the C terminal of RPL3 corresponding to a region with amino acids YHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHY
- Top Product
- Discover our top product RPL3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RPL3 Blocking Peptide, catalog no. 33R-10124, is also available for use as a blocking control in assays to test for specificity of this RPL3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPL3 (Ribosomal Protein L3 (RPL3))
- Alternative Name
- RPL3 (RPL3 Products)
- Synonyms
- ASC-1 antibody, L3 antibody, TARBP-B antibody, F2 antibody, J1 antibody, wu:fa99g02 antibody, wu:fb65e09 antibody, zgc:110350 antibody, CG4863 antibody, Dmel\\CG4863 antibody, Rpl3 antibody, anon-EST:GressD4 antibody, rpL3 antibody, ribosomal protein L3 antibody, 60S ribosomal protein L3 antibody, ribosomal protein L3 L homeolog antibody, 50S ribosomal protein L3 antibody, Ribosomal protein L3 antibody, RPL3 antibody, Rpl3 antibody, rpl-3 antibody, rpl3 antibody, rpl3.L antibody, RpL3 antibody
- Background
- Ribosomes, the complexes that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL3 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L3P family of ribosomal proteins and it is located in the cytoplasm. The protein can bind to the HIV-1 TAR mRNA, and it has been suggested that the protein contributes to tat-mediated transactivation.
- Molecular Weight
- 40 kDa (MW of target protein)
-