SNRPA1 antibody (N-Term)

Catalog No. ABIN633289

Product Details anti-SNRPA1 Antibody

Target: SNRPA1 (SNRPA) (Small Nuclear Ribonucleoprotein Polypeptide A (SNRPA))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SNRPA1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SNRPA1 antibody was raised against the N terminal of SNRPA1

Purification: Affinity purified

Immunogen: SNRPA1 antibody was raised using the N terminal of SNRPA1 corresponding to a region with amino acids VKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SNRPA1 Blocking Peptide, catalog no. 33R-9630, is also available for use as a blocking control in assays to test for specificity of this SNRPA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SNRPA1

Target: SNRPA1 (SNRPA) (Small Nuclear Ribonucleoprotein Polypeptide A (SNRPA))

Alternative Name: SNRPA1 (SNRPA Products)

Background: SNRPA1 contains 3 LRR (leucine-rich) repeats and belongs to the U2 small nuclear ribonucleoprotein A family. It is associated with sn-RNP U2 and helps the A' protein to bind stem loop IV of U2 snRNA.

Molecular Weight: 28 kDa (MW of target protein)