DAZAP1 antibody (Middle Region)

Catalog No. ABIN633290

The Rabbit Polyclonal anti-DAZAP1 antibody has been validated for WB. It is suitable to detect DAZAP1 in samples from Human.

Quick Overview for DAZAP1 antibody (Middle Region) (ABIN633290)

Target: DAZAP1 (DAZ Associated Protein 1 (DAZAP1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DAZAP1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DAZAP1 Antibody

Binding Specificity: Middle Region

Specificity: DAZAP1 antibody was raised against the middle region of DAZAP1

Purification: Affinity purified

Immunogen: DAZAP1 antibody was raised using the middle region of DAZAP1 corresponding to a region with amino acids GKKVEVKRAEPRDSKSQAPGQPGASQWGSRVVPNAANGWAGQPPPTWQQG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DAZAP1 Blocking Peptide, (ABIN938755), is also available for use as a blocking control in assays to test for specificity of this DAZAP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAZAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DAZAP1

Target: DAZAP1 (DAZ Associated Protein 1 (DAZAP1))

Alternative Name: DAZAP1

Background: In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region of the Y chromosome and is deleted in many azoospermic and severely oligospermic men. It is thought that the DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL also involved in germ cell development and gametogenesis. DAZAP1 is a RNA-binding protein with two RNP motifs that was originally identified by its interaction with the infertility factors DAZ and DAZL. Two isoforms are encoded by transcript variants of this gene.

Molecular Weight: 43 kDa (MW of target protein)