RTCD1 antibody (N-Term)

Catalog No. ABIN633294

This anti-RTCD1 antibody is a Rabbit Polyclonal antibody detecting RTCD1 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for RTCD1 antibody (N-Term) (ABIN633294)

Target: RTCD1 (RNA terminal Phosphate Cyclase Domain 1 (RTCD1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RTCD1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RTCD1 Antibody

Binding Specificity: N-Term

Specificity: RTCD1 antibody was raised against the N terminal of RTCD1

Purification: Affinity purified

Immunogen: RTCD1 antibody was raised using the N terminal of RTCD1 corresponding to a region with amino acids VQKIRAGRSTPGLRPQHLSGLEMIRDLCDGQLEGAEIGSTEITFTPEKIK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RTCD1 Blocking Peptide, (ABIN5615970), is also available for use as a blocking control in assays to test for specificity of this RTCD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTCD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RTCD1

Target: RTCD1 (RNA terminal Phosphate Cyclase Domain 1 (RTCD1))

Alternative Name: RTCD1

Background: RNA 3-prime-terminal phosphate cyclase catalyzes the ATP-dependent conversion of a 3-prime phosphate to a 2-prime,3-prime-cyclic phosphodiester at the end of RNA.

Molecular Weight: 39 kDa (MW of target protein)