CELF6 antibody
-
- Target See all CELF6 Antibodies
- CELF6 (CUGBP, Elav-Like Family Member 6 (CELF6))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CELF6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- BRUNOL6 antibody was raised using a synthetic peptide corresponding to a region with amino acids QAALLAAAQGPGLGPVAAVAAQMQHVAAFSLVAAPLLPAAAANSPPGSGP
- Top Product
- Discover our top product CELF6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
BRUNOL6 Blocking Peptide, catalog no. 33R-7452, is also available for use as a blocking control in assays to test for specificity of this BRUNOL6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BRUNOL6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CELF6 (CUGBP, Elav-Like Family Member 6 (CELF6))
- Alternative Name
- BRUNOL6 (CELF6 Products)
- Background
- BRUNOL6 is a RNA-binding protein implicated in the regulation of pre-mRNA alternative splicing. It mediates exon inclusion and/or exclusion in pre-mRNAs that are subject to tissue-specific and developmentally regulated alternative splicing. BRUNOL6 specifically activates exon 5 inclusion of TNNT2 in a muscle-specific splicing enhancer (MSE)-dependent manner. It also promotes exon exclusion of INSR pre-mRNA.
- Molecular Weight
- 50 kDa (MW of target protein)
-