CELF6 antibody

Catalog No. ABIN633299

Product Details anti-CELF6 Antibody

Target: CELF6 (CUGBP, Elav-Like Family Member 6 (CELF6))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CELF6 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: BRUNOL6 antibody was raised using a synthetic peptide corresponding to a region with amino acids QAALLAAAQGPGLGPVAAVAAQMQHVAAFSLVAAPLLPAAAANSPPGSGP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BRUNOL6 Blocking Peptide, catalog no. 33R-7452, is also available for use as a blocking control in assays to test for specificity of this BRUNOL6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BRUNOL6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CELF6

Target: CELF6 (CUGBP, Elav-Like Family Member 6 (CELF6))

Alternative Name: BRUNOL6 (CELF6 Products)

Synonyms: BRUNOL6 antibody, 6330569O16Rik antibody, Brunol6 antibody, CUGBP Elav-like family member 6 antibody, CUGBP, Elav-like family member 6 antibody, CELF6 antibody, Celf6 antibody

Background: BRUNOL6 is a RNA-binding protein implicated in the regulation of pre-mRNA alternative splicing. It mediates exon inclusion and/or exclusion in pre-mRNAs that are subject to tissue-specific and developmentally regulated alternative splicing. BRUNOL6 specifically activates exon 5 inclusion of TNNT2 in a muscle-specific splicing enhancer (MSE)-dependent manner. It also promotes exon exclusion of INSR pre-mRNA.

Molecular Weight: 50 kDa (MW of target protein)