DGCR8 antibody (N-Term)

Catalog No. ABIN633303

This anti-DGCR8 antibody is a Rabbit Polyclonal antibody detecting DGCR8 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for DGCR8 antibody (N-Term) (ABIN633303)

Target: DGCR8 (DiGeorge Syndrome Critical Region Gene 8 (DGCR8))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DGCR8 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DGCR8 Antibody

Binding Specificity: N-Term

Specificity: DGCR8 antibody was raised against the N terminal of DGCR8

Purification: Affinity purified

Immunogen: DGCR8 antibody was raised using the N terminal of DGCR8 corresponding to a region with amino acids DKKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DGCR8 Blocking Peptide, (ABIN937407), is also available for use as a blocking control in assays to test for specificity of this DGCR8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGCR8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DGCR8

Target: DGCR8 (DiGeorge Syndrome Critical Region Gene 8 (DGCR8))

Alternative Name: DGCR8

Background: DGCR8 contains 2 DRBM (double-stranded RNA-binding) domains and 1 WW domain. It may play a part in the etiology of the velocardiofacial/DiGeorge syndrome (VCFS/DGS), a developmental disorder characterized by structural and functional palate anomalies, conotruncal cardiac malformations, immunodeficiency, hypocalcemia, and typical facial anomalies.

Molecular Weight: 85 kDa (MW of target protein)

Pathways: Regulatory RNA Pathways