RBMS2 antibody (N-Term)

Catalog No. ABIN633313

This Rabbit Polyclonal antibody specifically detects RBMS2 in WB. It exhibits reactivity toward Human.

Quick Overview for RBMS2 antibody (N-Term) (ABIN633313)

Target: RBMS2 (RNA Binding Motif, Single Stranded Interacting Protein 2 (RBMS2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBMS2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RBMS2 Antibody

Binding Specificity: N-Term

Specificity: RBMS2 antibody was raised against the N terminal of RBMS2

Purification: Affinity purified

Immunogen: RBMS2 antibody was raised using the N terminal of RBMS2 corresponding to a region with amino acids MLLSVTSRPGISTFGYNRNNKKPYVSLAQQMAPPSPSNSTPNSSSGSNGN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBMS2 Blocking Peptide, (ABIN5615802), is also available for use as a blocking control in assays to test for specificity of this RBMS2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBMS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RBMS2

Target: RBMS2 (RNA Binding Motif, Single Stranded Interacting Protein 2 (RBMS2))

Alternative Name: RBMS2

Background: RBMS2 is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding.

Molecular Weight: 44 kDa (MW of target protein)