AGFG1 antibody (Middle Region)

Catalog No. ABIN633314

The Rabbit Polyclonal anti-AGFG1 antibody is suitable to detect AGFG1 in samples from Human and Mouse. It has been validated for WB.

Quick Overview for AGFG1 antibody (Middle Region) (ABIN633314)

Target: AGFG1 (HRB) (HIV-1 Rev Binding Protein (HRB))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AGFG1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-AGFG1 Antibody

Binding Specificity: Middle Region

Specificity: HRB antibody was raised against the middle region of HRB

Purification: Affinity purified

Immunogen: HRB antibody was raised using the middle region of HRB corresponding to a region with amino acids SQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HRB Blocking Peptide, (ABIN5614067), is also available for use as a blocking control in assays to test for specificity of this HRB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HRB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AGFG1

Target: AGFG1 (HRB) (HIV-1 Rev Binding Protein (HRB))

Alternative Name: HRB

Background: HRB is related to nucleoporins, a class of proteins that mediate nucleocytoplasmic transport. HRB binds the activation domain of the human immunodeficiency virus Rev protein when Rev is assembled onto its RNA target, and is required for the nuclear export of Rev-directed RNAs.

Molecular Weight: 58 kDa (MW of target protein)