Nucleolar Protein 6 antibody

Catalog No. ABIN633317

The Rabbit Polyclonal anti-Nucleolar Protein 6 antibody has been validated for WB. It is suitable to detect Nucleolar Protein 6 in samples from Human, Mouse and Rat.

Quick Overview for Nucleolar Protein 6 antibody (ABIN633317)

Target: Nucleolar Protein 6 (NOL6)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Nucleolar Protein 6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Nucleolar Protein 6 Antibody

Purification: Affinity purified

Immunogen: NOL6 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRKRTLAEPPAKGLLQPVKLSRAELYKEPTNEELNRLRETEILFHSSLLR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NOL6 Blocking Peptide, (ABIN5615021), is also available for use as a blocking control in assays to test for specificity of this NOL6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOL6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Nucleolar Protein 6

Target: Nucleolar Protein 6 (NOL6)

Alternative Name: NOL6

Background: NOL6 is a nucleolar RNA-associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts. The nucleolus is a dense subnuclear membraneless organelle that assembles around clusters of rRNA genes and functions in ribosome biogenesis.

Molecular Weight: 127 kDa (MW of target protein)